PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 391aa    MW: 43871.3 Da    PI: 4.2138
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911663.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-5171351129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd elv++yLk+kv gk++++ e+i e+++yk+ PwdLp k +++++++ewyfF++rd+ky++g+r+nrat+ gyWk+tgkd++v+
  XP_010911663.1   7 LPPGFRFHPTDVELVQYYLKRKVMGKSFQF-EAICEIELYKFAPWDLPdKsRLRSKDQEWYFFCPRDRKYPNGSRTNRATDVGYWKTTGKDRTVI 100
                     79***************************9.89**************96358888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + k+++vg+k+tL+f+ g+ap+g++tdWvm eyrle
  XP_010911663.1 101 H-KSHTVGMKRTLIFHVGKAPRGNRTDWVMYEYRLE 135
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-603157IPR003441NAC domain
PROSITE profilePS5100557.0647157IPR003441NAC domain
PfamPF023651.6E-278134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MMDKTLLPPG FRFHPTDVEL VQYYLKRKVM GKSFQFEAIC EIELYKFAPW DLPDKSRLRS  60
KDQEWYFFCP RDRKYPNGSR TNRATDVGYW KTTGKDRTVI HKSHTVGMKR TLIFHVGKAP  120
RGNRTDWVMY EYRLEDKELL NAGYSLDAYV LCKIFQKSGR GPKIGEQYGA PFNEEDWEDD  180
PIVDNAISFP CASSPKPPDD QPILLEPICE ESVAAGVCEI SSSAVVDKNI NEVCGVETGI  240
YAELEDLCAQ GGINNNLNCS GTINSEYELQ PVLTELGCEQ YMELNDIYSL WEGDPSDLVV  300
PSDLFVQYPL VENPSSPNLN NMDVQNFSIG SVAAALNDPF PAGTGMVADQ SAVFLEMEDF  360
GRSVPEMSAP VYEVDGDETI LQESVASSQM N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-54716320174NAC domain-containing protein 19
3swm_B4e-54716320174NAC domain-containing protein 19
3swm_C4e-54716320174NAC domain-containing protein 19
3swm_D4e-54716320174NAC domain-containing protein 19
3swp_A4e-54716320174NAC domain-containing protein 19
3swp_B4e-54716320174NAC domain-containing protein 19
3swp_C4e-54716320174NAC domain-containing protein 19
3swp_D4e-54716320174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911663.10.0PREDICTED: NAC domain-containing protein 89-like isoform X2
TrEMBLM0RQN01e-133M0RQN0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P09000_0011e-133(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-83NAC domain containing protein 2